PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012104P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 426aa    MW: 46367.5 Da    PI: 8.6269
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012104P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-3998158262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  MELO3C012104P1  98 PDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSS 158
                     7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3096155IPR003851Zinc finger, Dof-type
PfamPF027016.5E-32100156IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882102156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610104140IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MAEVEMRDPI IKLFGKTISL PSDSKFLSSE TTEKETSCEE LGLEKEGNSS GNQITDQTTS  60
GVSENPLEER EISSPKASKN EEQSETSNSP DNKTSKKPDK ILPCPRCNSM DTKFCYFNNY  120
NVNQPRHFCK NCQRYWTAGG TMRNVPVGAG RRKNKNSSSS HFRQLIIPDG GIHPHQFLDN  180
NGTFLTFASD SSISNSQSCN PNGFLINTEN GDDHSSKSSI TVSNSSEKGA KMASQQSIAK  240
NVFPFLPQLQ SFTGLSLPYS SITPPSAPFY PPGIPVSYYP SQPYWGYLAP PSLTIINPNS  300
QNSSTNSSVL GKRSRDGKLV KSPSNTESEI VKQKNSEEPS LGIPKTMKVD DPNEAAKSSI  360
WSTLGIKNDK KAGGGSTSTT INGGSLFVSL QRSTKGKEET QIESWSLLQA NPAAFSRALK  420
FREIV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008446369.10.0PREDICTED: cyclic dof factor 1
TrEMBLA0A0A0KSR00.0A0A0A0KSR0_CUCSA; Uncharacterized protein
STRINGVIT_14s0108g00980.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2461733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-63cycling DOF factor 1